Analytical Data
-
Gene name
SPG
- Application
-
Alternative Names
SPG；Sperm-associated antigen 17
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P19909
-
Expression Region
291-497aa
-
AA Sequence
IDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
-
Molecular Weight
26.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPG (spastic paraplegia) is a group of inherited neurological disorders characterized by progressive weakness and stiffness of the legs, often due to degeneration of the upper motor neurons. The research into SPG-related proteins primarily focuses on understanding the molecular mechanisms underlying these conditions, which can lead to potential therapeutic strategies. Various proteins implicated in SPG, such as SPAST, KIF5A, and ATL1, play crucial roles in cytoskeletal dynamics, axonal transport, and mitochondrial function, which are essential for maintaining neuronal integrity. The dysfunction of these proteins can disrupt normal cellular processes, leading to the characteristic symptoms of spastic paraplegia. Recent studies have employed advanced techniques such as gene editing, protein expression analysis, and animal models to elucidate the structure-function relationships of these proteins, paving the way for targeted treatments. By characterizing the biochemical pathways involved, researchers aim to identify potential biomarkers for early diagnosis and to develop innovative therapeutic interventions that could mitigate disease progression and improve the quality of life for affected individuals. Understanding the role of SPG proteins in cellular health is not only vital for comprehending spastic paraplegia but also offers insights into broader neurodegenerative processes, making this a significant area of research in neurology and genetics.
