Analytical Data
-
Gene name
NOG
- Application
-
Alternative Names
NOG;Noggin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13253
-
Expression Region
28-232aa
-
AA Sequence
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
-
Molecular Weight
58.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on NOG (Noggin) recombinant proteins has gained significant attention in recent years due to their critical role in developmental biology and tissue engineering. NOG is a well-known bone morphogenetic protein (BMP) antagonist, originally identified in studies of vertebrate limb development and embryogenesis. It plays a crucial function in regulating the activity of BMPs, which are essential for bone formation, skeletal patterning, and the maintenance of various tissues. Aberrant NOG expression has been implicated in several pathological conditions, including skeletal malformations and cancer, making it a valuable focus for therapeutic interventions. Given the increasing interest in regenerative medicine and stem cell therapy, recombinant NOG proteins offer a promising avenue for enhancing tissue regeneration and repair by modulating BMP signaling pathways. Additionally, these proteins serve as valuable tools in understanding the molecular mechanisms underlying embryonic development and differentiation processes. Recent advancements in recombinant protein technology have enabled the production of high-purity NOG proteins, facilitating further exploration of their biological functions and potential applications in clinical settings. As research in this area progresses, NOG proteins are expected to contribute significantly to the development of novel strategies for treating developmental disorders and enhancing regenerative therapies.











