Analytical Data
-
Gene name
vsdF
- Application
-
Alternative Names
vsdF；Virulence Protein VsdF
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24421
-
Expression Region
1-119aa
-
AA Sequence
MLRATKVCIYPTPEQAEHLNAQFGAVRFVYSKSLHIKKHAYQRHGVSLTPRKDIKPLLAVAKKFRKFRKFRKYAWLKEYDSIALQQAVINLDVAFSNCFNPKLKARFPMFKRKHGKLLG
-
Molecular Weight
26.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of VSDf recombinant proteins has garnered significant interest in the fields of molecular biology and biotechnology due to their crucial role in understanding the function of voltage-sensing domains (VSDs) in membrane proteins. VSDs are integral components of various ion channels, such as voltage-gated sodium, potassium, and calcium channels, which are essential for cellular excitability and signal transduction. Research into VSDf proteins focuses on utilizing recombinant DNA technology to produce these proteins in a controlled laboratory setting, enabling scientists to investigate their structure, function, and interaction with other cellular components. By analyzing VSDf, researchers aim to elucidate the mechanisms of voltage sensing and gating in ion channels, contributing to a deeper understanding of neuronal signaling and the physiological processes that are affected by ionic currents. Furthermore, insights gained from VSDf research have potential implications for the development of targeted therapies for voltage-related diseases, such as epilepsy and cardiac arrhythmias. Through the production of recombinant VSDf proteins, scientists can conduct biophysical and biochemical studies, leading to advancements in our knowledge of cellular communication and paving the way for innovative medical applications.
