Cat: PA1000-2162

Recombinant Human NME3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NME3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GRIN2C;NMDAR2C;Glutamate receptor ionotropic. NMDA 2C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13232

  • Expression Region

    1-169aa

  • AA Sequence

    MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGF KLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDV VRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALW FRADELLCWEDSAGHWLYE

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NME3, a member of the nucleoside diphosphate kinase (NDPK) family, plays a crucial role in cellular processes such as signal transduction and the regulation of cell proliferation. Its involvement in various biological functions, including nucleotide metabolism and cellular energy homeostasis, highlights its significance in maintaining cellular equilibrium. Studies have indicated that NME3 may also participate in tumorigenesis, making it a potential biomarker for cancer progression. Researchers have shown that the protein interacts with various signaling pathways, influencing factors such as cell survival and apoptosis. Given its multifaceted roles, the recombinant expression of NME3 is of great interest for both functional studies and therapeutic applications. By producing NME3 in a recombinant form, scientists can investigate its biochemical properties, binding interactions, and structural characteristics. This research may facilitate the development of novel approaches for targeting NME3 in cancer therapy or other diseases where its function is implicated. Understanding the detailed mechanism of NME3 can further elucidate its contributions to cellular physiology and pathophysiology, paving the way for innovative treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US