Analytical Data
-
Gene name
LRRC18
- Application
-
Alternative Names
LRRC18; UNQ9338/PRO34010; Leucine-rich repeat-containing protein 18
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N456
-
Expression Region
1-261aa
-
AA Sequence
MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS
-
Molecular Weight
56.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC18 (Leucine Rich Repeat Containing 18) is a gene that encodes a protein implicated in various cellular processes, primarily involving immune responses and inflammation. Recent studies have highlighted its potential role in modulating the activity of immune cells such as macrophages and dendritic cells. Given the importance of the immune system in health and disease, LRRC18 has attracted attention for its possible involvement in pathological conditions, including autoimmune diseases and cancer. Research on recombinant LRRC18 protein aims to elucidate its structure, functional properties, and interaction with other proteins, which could reveal its biological roles and mechanistic pathways. Understanding LRRC18’s functions may facilitate the development of targeted therapies that harness or inhibit its activity, offering new avenues for treatment strategies. Furthermore, the recombinant production of LRRC18 allows for in-depth studies using biochemical assays and functional analyses, contributing to the broader comprehension of immune modulation and its implications in therapeutic contexts. As such, LRRC18 represents a promising area of research in immunology, with the potential to uncover novel insights into immune regulation and disease mechanisms.
