Cat: PA1000-2132

Recombinant Human NEIL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NEIL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NEIL2;Endonuclease 8-like 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q969S2

  • Expression Region

    1-332aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMPEGPLVRKFHHLVSPFVGQQVVKTG GSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQK EVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGD AGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLA FYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYF SGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKF QGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEP EQCQFS

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The NEIL2 protein, a member of the NEIL family of DNA glycosylases, plays a crucial role in the base excision repair (BER) pathway, which is essential for maintaining genomic integrity. It is primarily responsible for recognizing and excising damaged bases resulting from oxidative stress, thereby preventing the accumulation of mutations that can lead to various diseases, including cancer. Research has indicated that NEIL2 preferentially targets oxidized bases, such as 8-oxoguanine, and interacts with other repair proteins to facilitate efficient DNA repair processes. Given its importance in genome maintenance, studying NEIL2 has significant implications for understanding the molecular mechanisms behind DNA repair, the role of oxidative damage in aging and disease, and the development of potential therapeutic strategies. Investigating the regulatory mechanisms and structural features of NEIL2 may also provide insights into its functional diversity and interactions with other cellular components involved in DNA repair pathways. Overall, the exploration of NEIL2's function and mechanisms presents a promising avenue for advancing our knowledge of cellular responses to DNA damage and maintaining cellular homeostasis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US