Cat: PA2000-615DB

Recombinant Human GALNS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GALNS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GALNS;N-acetylgalactosamine-6-sulfatase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P34059

  • Expression Region

    1-522aa

  • AA Sequence

    MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYG EPSRETPNLDRMAAEGLLFPNFYSANPLCSPSRAALLTGRLPIRNGFYTT NAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGKWHLGHRPQFH PLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKT GEANLTQIYLQEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQ RGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQG GSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL ALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKA HFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGE RFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPG CEKLGKCLTPPESIPKKCLWSH

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GALNS (N-acetylgalactosamine-6-sulfatase) is a key enzyme involved in the lysosomal degradation of glycosaminoglycans, specifically in the metabolism of keratan sulfate and chondroitin sulfate. Deficiency in GALNS activity leads to mucopolysaccharidosis type IV (MPS IV), also known as Morquio syndrome, a rare genetic disorder characterized by skeletal abnormalities, joint stiffness, and other systemic issues. The study of GALNS protein is essential for understanding the molecular basis of MPS IV, which can provide insights into potential therapeutic approaches. Researchers have focused on the recombinant production of GALNS to explore its structure, function, and potential for enzyme replacement therapy. By utilizing techniques such as gene cloning, expression in heterologous systems, and purification, scientists aim to produce active GALNS protein for functional studies and preclinical trials. Investigating the biochemical properties of GALNS and understanding the impact of specific mutations on its activity can help in designing effective treatment strategies for affected individuals. Moreover, the recombinant GALNS can be instrumental in developing diagnostic tools for early detection of MPS IV. The exploration of GALNS not only enhances our comprehension of lysosomal storage disorders but also underscores the importance of biopharmaceutical advancements in addressing rare genetic conditions. Through ongoing research, there is hope for improved therapeutic options to manage MPS IV and enhance the quality of life for patients suffering from this debilitating disorder.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US