Analytical Data
-
Gene name
NEDD8
- Application
-
Alternative Names
NEDD8;NEDD8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15843
-
Expression Region
1-76aa
-
AA Sequence
MGHHHHHHGSLQDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIK KTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIE AHREQIGGMLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQR LIYSGKQMNDEKTAADYKILGGSVLHLVLALRGG
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NEDD8 (Neural Precursor Cell-Expressed Developmentally Downregulated 8) is a small ubiquitin-like protein that plays a crucial role in regulating various cellular processes, including cell-cycle progression, signal transduction, and protein degradation. Research into NEDD8 has gained momentum due to its involvement in the activation of cullin-RING ligases (CRLs), a family of enzymes responsible for ubiquitination and subsequent proteasomal degradation of target proteins, which is essential for maintaining cellular homeostasis. Dysregulation of NEDD8 and its associated pathways has been implicated in several diseases, including cancer, where aberrant protein turnover can lead to the accumulation of oncogenic factors or the loss of tumor suppressors. Consequently, NEDD8 has emerged as a promising target for therapeutic intervention. Studies focusing on NEDD8 modification mechanisms and its role in oncogenic signaling pathways have provided insights into its potential as a biomarker for cancer prognosis and as a target for novel drug development. The engineering and characterization of recombinant NEDD8 proteins have facilitated in vitro studies, enabling researchers to elucidate its structure-function relationships and interactions with other ubiquitin-like proteins and ligases. This foundational research lays the groundwork for developing NEDD8 inhibitors, which may offer new avenues for cancer treatment and a deeper understanding of proteostasis in both normal and diseased states. As research progresses, the therapeutic targeting of the NEDD8 pathway holds promise for the development of innovative strategies in oncology and beyond.
