Analytical Data
-
Gene name
TMEM72
- Application
-
Alternative Names
TMEM72；C10orf127；KSP37；Transmembrane Protein 72
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A0PK05
-
Expression Region
1-275aa
-
AA Sequence
MQLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLQGQFKSLAFYLLFTGAAVSICEGAYFVAQLLAICFQCQPGSLADRVREKAHWLGCFQKFLAYLLLSVACFLHPVLVWHVTIPGSMLIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF
-
Molecular Weight
36.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM72, or Transmembrane Protein 72, is a newly identified protein that has garnered attention in recent years due to its potential roles in various biological processes and diseases. It is primarily expressed in the brain and testis, suggesting a specific involvement in neuronal and reproductive functions. Research has shown that TMEM72 is implicated in cell signaling pathways and may play a role in cellular stress responses, which could have implications for neurodegenerative diseases and reproductive health. The study of TMEM72 is further complicated by its unique transmembrane structure, which raises questions about its interactions with other membrane proteins and its functional significance in cellular processes. Recombinant TMEM72 protein production has emerged as a valuable tool for elucidating its biological functions and potential therapeutic applications. Understanding the molecular mechanisms of TMEM72 can provide insights into its role in pathophysiological conditions and might pave the way for new strategies in diagnosing and treating related diseases. As such, ongoing research into TMEM72, including the characterization of its structure, expression patterns, and functional assays, is crucial for uncovering its biological significance and potential applications in medicine.
