Analytical Data
-
Gene name
STEAP1B
- Application
-
Alternative Names
STEAP1B；STEAP family member 1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NZ63
-
Expression Region
1-245aa
-
AA Sequence
MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL
-
Molecular Weight
30.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
STEAP1B, a member of the six transmembrane epithelial antigen of the prostate (STEAP) family, has garnered attention in cancer research due to its potential role in tumor progression and metastasis, particularly in prostate cancer. It is primarily expressed in prostate tissues, and its expression levels have been correlated with tumor aggressiveness and poor prognosis. The protein plays a pivotal role in cellular processes such as iron homeostasis and cell proliferation. Research into STEAP1B often focuses on its molecular mechanisms, including its involvement in the development of cancer stem-like properties in tumors. Furthermore, STEAP1B has emerged as a promising target for immunotherapy, prompting the exploration of recombinant protein production for developing diagnostic and therapeutic applications. Understanding the structure and function of STEAP1B at a molecular level may lead to the development of novel therapeutic strategies and improve patient outcomes. The study of recombinant STEAP1B protein not only aids in elucidating its biological functions but also facilitates the generation of specific antibodies for potential clinical applications, highlighting its significance in cancer research and treatment.
