Analytical Data
-
Gene name
Ile
- Application
-
Alternative Names
Ile;CHS1;COH1;KIAA0532;Intermembrane lipid transfer Protein VPS13B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P08004
-
Expression Region
4-200aa
-
AA Sequence
QNNRSRNEYHSNRKNEPSYELQNAHSGLFHSSNEELTNRNQRYTNQNASMGSFTPVQSLQFPEQSQQTNMLYNGDDGNNNTINDNERDIYGGFVNHHRQRPPPATAEYNDVFNTNSQQLPSEHQYNNVPSYPLPSINVIQTTPELIHNGSQTMATPIERPFFNENDYYYNNRNSRTSPSIASSSDGYADQEARPILE
-
Molecular Weight
26.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ile reprogramming proteins are a focal point in contemporary biochemical research due to their critical role in cellular functions and potential applications in biotechnology and medicine. These proteins are involved in the intricate processes of cellular signaling, gene expression, and protein synthesis, making them essential for maintaining cellular homeostasis. Recent advancements in synthetic biology have enabled researchers to manipulate Ile pathways, leading to new insights into cellular mechanisms and the development of innovative therapeutic strategies. For instance, the reprogramming of these proteins has shown promise in cancer treatment by altering tumor cell metabolism or enhancing the efficacy of existing therapies. Additionally, the study of Ile reprogramming proteins provides valuable information about the evolutionary adaptations of organisms, helping to elucidate how they respond to environmental changes. As such, ongoing investigations into these proteins not only enhance our understanding of fundamental biological processes but also pave the way for the creation of novel biotechnological tools and therapeutic agents that could address various health-related challenges.











