Cat: PA1000-2115

Recombinant Human NDUFA4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NDUFA4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NDUFA4;Cytochrome c oxidase subunit NDUFA4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00483

  • Expression Region

    38-81aa

  • AA Sequence

    LFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF

  • Molecular Weight

    32.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NDUFA4, or NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4, is a critical component of the mitochondrial respiratory chain, specifically involved in complex I, which is pivotal for ATP production through oxidative phosphorylation. Research into NDUFA4 has gained prominence due to its potential implications in various diseases, including neurodegenerative disorders and certain types of cancer. The protein's role in maintaining mitochondrial function and its involvement in cellular energy metabolism underscore its significance in health and disease. Moreover, NDUFA4 has been shown to interact with other protein complexes and may influence the balance between cell survival and apoptosis, making it a target of interest for therapeutic interventions. The recombinant production of NDUFA4 enables detailed structural and functional studies, allowing researchers to investigate its precise mechanism of action and its interactions within the respiratory chain. Understanding these aspects could provide insights into the pathogenic mechanisms underlying mitochondrial dysfunction and aid in the development of targeted therapies for diseases associated with impaired energy metabolism. The ongoing research aims to elucidate the role of NDUFA4 not only in mitochondrial bioenergetics but also in broader cellular contexts, thereby expanding our knowledge of its biological importance.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US