Analytical Data
-
Gene name
LOC91461
- Application
-
Alternative Names
FLJ18197; Hypothetical protein BC007901; Hypothetical protein LOC91461; MGC125960; Pkdcc; PKDCC_HUMAN; Protein kinase domain containing cytoplasmic; Protein kinase domain containing. cytoplasmic homolog (mouse); Protein kinase domain-containing protein. cytoplasmic; Protein kinase-like protein SgK493; SGK493; Sugen kinase 493
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q504Y2
-
Expression Region
1-294aa
-
AA Sequence
MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
-
Molecular Weight
59.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC91461 is a protein-coding gene that has garnered attention in recent years due to its potential role in various biological processes and diseases. Research has indicated that LOC91461 may be involved in cellular signaling pathways, influencing cell proliferation and differentiation. The gene's expression patterns suggest its possible involvement in developmental processes and tissue homeostasis. Additionally, studies have begun to explore the relationship between LOC91461 and certain pathological conditions, particularly in cancer biology, where aberrant expression levels have been associated with tumor progression and metastasis. Understanding the structure and function of the LOC91461 recombinant protein is crucial for elucidating its role in these processes. Advanced techniques, such as recombinant DNA technology, enable the production of this protein for functional assays, which can provide insights into its molecular mechanisms and interactions with other cellular components. Furthermore, the investigation of LOC91461 could lead to the identification of novel biomarkers for early diagnosis and potential therapeutic targets in disease management. Overall, the study of LOC91461 is significant not only for advancing our understanding of its biological functions but also for its implications in health and disease. Continued research in this area holds promise for developing new strategies in regenerative medicine and targeted therapies.
