Analytical Data
-
Gene name
Nkg7
- Application
-
Alternative Names
Nkg7；GIG1；Protein NKG7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16617
-
Expression Region
1-165aa
-
AA Sequence
MEPCRSLALFAGSLGLTSSLIALTTDFWIVATGPHFSAHSGLWPTSQETQVAGYIHVTQSFCILAVLWGLVSVSFLILSCIPALSAPGRGPLVSTVMAFSAALSILVAMAVYTSMRWSQTPFSQVQTFFSWSFYLGWVSFILFLFAGCLSLGAHCRTRRAEYETL
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
NKG7 (Natural Killer Group 7) is a member of the granzyme family of proteins, primarily expressed in natural killer (NK) cells and cytotoxic T lymphocytes. Its role is crucial in the immune response, particularly in mediating cytotoxicity against virus-infected and tumor cells. Recent studies have highlighted the significance of NKG7 in modulating immune responses, revealing its involvement in the regulation of cellular proliferation, apoptosis, and the secretion of inflammatory cytokines. Research has demonstrated that NKG7 is upregulated in various disease contexts, including cancer and viral infections, suggesting its potential as a biomarker for disease progression and therapeutic response. Moreover, understanding the structure and function of NKG7 can provide insights into its mechanisms of action, enabling the development of novel immunotherapeutic strategies. As a recombinantly expressed protein, NKG7 offers opportunities for detailed functional studies and high-throughput screening in drug discovery. Consequently, ongoing research focuses on elucidating the precise roles of NKG7, exploring its interaction with other immune molecules, and leveraging its function in enhancing anti-tumor immunity. This makes NKG7 a promising target for innovative therapeutic approaches in cancer immunotherapy and infectious disease management.
