Analytical Data
-
Gene name
LOC92912
- Application
-
Alternative Names
LOC92912; UB2Q2_HUMAN; UBE2Q2; Ubiquitin carrier protein Q2; Ubiquitin conjugating enzyme E2Q 2; Ubiquitin conjugating enzyme E2Q family member 2; Ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q (putative) 2; Ubiquitin-protein ligase Q2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVN8
-
Expression Region
1-375aa
-
AA Sequence
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENLAILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWHVKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGGGALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQIHEKNGWYTPPKEDG
-
Molecular Weight
58.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC92912, a gene of interest within the field of molecular biology, has garnered attention due to its potential roles in cellular processes and disease mechanisms. Preliminary studies suggest LOC92912 may be involved in key regulatory pathways, influencing gene expression and protein interactions. Research on the recombinant protein derived from LOC92912 focuses on its structural and functional characteristics, which could provide insights into its biological significance. Understanding the protein's structure through techniques like X-ray crystallography or NMR spectroscopy could reveal active sites and potential binding partners, facilitating the exploration of its role in various physiological and pathological conditions. Additionally, investigating the protein's expression patterns across different tissues and developmental stages may offer clues about its functional significance in health and disease. Given the increasing interest in precision medicine, elucidating the functions of LOC92912 and its protein products may also have implications for therapeutic strategies, particularly in disorders where aberrant gene expression is implicated. Thus, research on LOC92912 recombinant protein not only contributes to the fundamental understanding of gene function but also holds promise for practical applications in biomedicine. As further studies unveil its potential interactions and pathways, LOC92912 may emerge as a pivotal player in the intricate network of cellular regulation, paving the way for innovative approaches to diagnosis and treatment.
