Analytical Data
-
Gene name
LOC399818
- Application
-
Alternative Names
C10orf138; Chromosome 10 open reading frame 138; EC 2.1.1.-; Em:AC068896.3; FLJ13019; LOC399818; Methyltransferase like 10; Methyltransferase-like protein 10; Mettl10; MTL10_HUMAN; OTTHUMP00000020696
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5JPI9
-
Expression Region
1-192aa
-
AA Sequence
MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM
-
Molecular Weight
47.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC399818 is a gene of interest that encodes a protein with potential implications in various biological processes and disease states. Recent advancements in genomic technologies have highlighted the importance of long non-coding RNAs and their associated proteins in regulating gene expression and cellular functions. Research surrounding LOC399818 aims to elucidate its function in cellular pathways and its role in diseases, particularly in the context of cancer and developmental disorders. Increasing evidence suggests that misregulation of genes like LOC399818 could contribute to pathophysiological conditions, making it a potential biomarker for diagnosis or a target for therapeutic intervention. Current studies are focused on characterizing the recombinant protein originating from LOC399818, examining its structural properties, interactions with other cellular components, and its functional implications in signaling pathways. By understanding the biochemical properties of this protein, researchers hope to uncover its role in health and disease, paving the way for novel diagnostic and therapeutic approaches. The exploration of LOC399818 not only enhances our understanding of gene function and regulation but also contributes to the broader field of molecular biology and personalized medicine.
