Analytical Data
-
Gene name
NCR3
- Application
-
Alternative Names
NCR3;1C7;LY117;Natural cytotoxicity triggering receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14931
-
Expression Region
19-135aa
-
AA Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRN GTPEFRGRLA PLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLG VGTGNGTRLVVEKEHPQLG
-
Molecular Weight
40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nuclear receptor corepressor 3 (NCR3), a member of the nuclear receptor corepressor family, plays a critical role in the regulation of gene expression by interacting with nuclear receptors and other transcription factors. The study of NCR3 has gained attention due to its involvement in various physiological processes and pathological conditions, including cancer, metabolic disorders, and neurodegenerative diseases. NCR3 functions primarily by mediating transcriptional repression, which is essential for maintaining cellular homeostasis. Dysregulation of NCR3 expression or function can lead to aberrant gene expression patterns, contributing to disease progression. Recent advances in molecular biology techniques, including CRISPR/Cas9 and high-throughput sequencing, have enabled researchers to explore the precise mechanisms by which NCR3 influences transcriptional networks. Furthermore, the identification of NCR3's interactions with specific ligands and co-factors has opened new avenues for therapeutic interventions. Understanding the functional dynamics of NCR3 in different cellular contexts is crucial for developing targeted treatments that harness its repressive capabilities. This research area holds promise for uncovering novel biomarkers and therapeutic targets, particularly in cancer where transcriptional dysregulation is a hallmark. As ongoing studies continue to elucidate the multifaceted roles of NCR3, it is anticipated that insights gained will contribute significantly to our understanding of gene regulation and its implications in health and disease.











