Analytical Data
-
Gene name
NCR2
- Application
-
Alternative Names
NCOR2;CTG26;Nuclear receptor corepressor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95944
-
Expression Region
19-130aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSQAQSKAQVLQSVAGQTLTVRCQYPPTGS LYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMT DLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NCR2, or Natural Cytotoxicity Triggering Receptor 2, is a member of the NK cell receptor family that plays a critical role in the immune response, particularly in the activation and regulation of natural killer (NK) cells. These cells are essential for the body's innate immune defense against tumors and virally infected cells. Research into NCR2 has gained prominence due to its potential as a therapeutic target in cancer immunotherapy. Studies have indicated that NCR2 can enhance NK cell-mediated cytotoxicity, making it a valuable candidate for developing new immunotherapeutic strategies. Additionally, understanding the molecular mechanisms underlying NCR2 signaling could provide insights into enhancing NK cell function and improving anti-tumor responses. The recombination of NCR2 into a functional protein form has opened up avenues for detailed exploration of its role in immune responses, as well as its application in clinical settings. By elucidating the interactions of NCR2 with its ligands and downstream signaling pathways, researchers aim to harness the full potential of NK cells in combating malignancies and improving patient outcomes in cancer therapies.











