Cat: PA1000-2084

Recombinant Human NANS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NANS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NANS;SAS;Sialic acid synthase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NR45

  • Expression Region

    1-359aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPLELELCPGRWVGGQHPCFIIAEIGQNHQ GDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERPYTSKHSWGKT YGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFF KVGSGDTNNFPYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFC FLQCTSAYPLQPEDVNLRVISEYQKLFPDIPIGYSGHETGIAISVAAVAL GAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNL VGKKVLVTVEEDDTIMEELVDNHGKKIKS

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NANS (N-acetylneuraminic acid synthase) is an important enzyme involved in the biosynthesis of sialic acid, a crucial component of glycoconjugates on the cell surface that play significant roles in cell signaling, immunity, and pathogen recognition. The interest in the study of NANS recombinant protein has grown due to its potential applications in biotechnology and medicine. Understanding NANS function can enhance our knowledge of sialylation processes, which are vital for proper physiological functions and have implications in various diseases, including cancer, neurodegenerative disorders, and infectious diseases. Recombinant NANS protein production allows researchers to investigate the enzyme's structural properties, substrate specificity, and catalytic mechanisms in detail. Additionally, exploring engineered variants of NANS can yield insights into its potential biotechnological applications, such as the development of novel therapeutics and diagnostic tools targeting sialic acid pathways. The increasing prevalence of sialylation-related diseases emphasizes the need for deeper research into NANS, and by utilizing recombinant technologies, researchers aim to unravel the complexities of sialic acid metabolism, leading to advancements in both fundamental science and applied biotechnology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US