Analytical Data
-
Gene name
CCR9
- Application
-
Alternative Names
CCR9；GPR28；C-C chemokine receptor type 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51686
-
Expression Region
1-369aa
-
AA Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCR9, or C-C chemokine receptor type 9, is a G-protein coupled receptor primarily expressed on T cells and known for its critical role in immune response and inflammation. It serves as a key mediator in the migration of T cells to the gut, making it particularly relevant in the study of inflammatory bowel diseases (IBD) such as Crohn's disease and ulcerative colitis. The receptor specifically interacts with its ligand, CCL25, which is highly expressed in intestinal tissues. Given the involvement of CCR9 in the pathogenesis of IBD, the development of recombinant CCR9 proteins has garnered significant research interest. These proteins can be utilized to elucidate the mechanistic pathways underlying T cell trafficking, and they provide a valuable tool for drug discovery and therapeutic interventions aimed at modulating immune responses. The recombinant CCR9 protein can be employed in various assays, including binding studies and functional assays, to screen for potential small molecule inhibitors or neutralizing antibodies that may reduce aberrant T cell migration in inflammatory conditions. Furthermore, understanding the structure and function of CCR9 may lead to the identification of novel therapeutic targets and strategies for managing IBD and related disorders. This research is particularly critical as it addresses the growing need for effective treatments that offer remission and improved quality of life for patients suffering from chronic intestinal inflammation.
