Analytical Data
-
Gene name
MYL6B
- Application
-
Alternative Names
MYL6B;MLC1SA;Myosin light chain 6B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14649
-
Expression Region
1-208aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPPKKDVPVKKPAGPSISKPAAKPAAA GAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFD RVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETF LPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKM TEEEVETVLAGHEDSNGCINYEAFLKHILSV
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYL6B is a member of the myosin light chain family, which plays a crucial role in muscle contraction and various cellular processes, including signal transduction and cytoskeletal organization. Research into MYL6B has gained attention due to its potential involvement in cardiovascular diseases and muscle-related disorders. Increased understanding of MYL6B and its interactions with myosin heavy chains and other proteins is essential for elucidating the molecular mechanisms underlying muscle function and motility. Recombinant MYL6B protein allows for detailed biochemical and biophysical studies, aiding in the exploration of its role within the cellular context. Investigating MYL6B's structural and functional properties may reveal insights into its regulatory mechanisms and potential therapeutic targets. As a result, the production of MYL6B as a recombinant protein is pivotal for advancing our knowledge in muscle biology and developing strategies to address related pathologies. This research not only contributes to fundamental science but also has implications for biomedical applications, including drug design and muscle regeneration therapies.
