Analytical Data
-
Gene name
MYL6
- Application
-
Alternative Names
MYL6;Myosin light polypeptide 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60660
-
Expression Region
1-151aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMCDFTEDQTAEFKEAFQLFDRTGDGKILYS QCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKN KDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVA GHEDSNGCINYEELVRMVLNG
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MYL6, or Myosin Light Chain 6, is a crucial component of the contractile apparatus in muscle cells, playing a vital role in muscle contraction and cellular motility. Studies have shown that MYL6 is involved in various physiological processes, including cardiac function and smooth muscle contractions. Research into the recombinant expression of MYL6 has gained traction due to its potential implications in cardiovascular diseases and muscle disorders. The ability to produce MYL6 as a recombinant protein allows scientists to investigate its structural and functional properties in detail, facilitating a better understanding of its role in heart and skeletal muscle biology. Furthermore, the recombinant protein can be utilized in various applications, including drug development and regenerative medicine, providing insights into therapeutic strategies for muscle-related conditions. As such, the exploration and characterization of MYL6 recombinant protein are pivotal in both basic research and clinical applications, contributing to the advancement of knowledge in muscle physiology and pathology.











