Analytical Data
-
Gene name
LHX3
- Application
-
Alternative Names
LIM homeobox protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBR4
-
Expression Region
1-397aa
-
AA Sequence
MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
-
Molecular Weight
44.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LHX3 (LIM homeobox 3) is a member of the LIM homeodomain protein family, essential for the development of various neural and endocrine tissues. It plays a pivotal role in the differentiation of hypothalamic neurons and the formation of the pituitary gland. Abnormalities in LHX3 expression are associated with congenital disorders such as combined pituitary hormone deficiency and diabetes insipidus, highlighting its importance in endocrine function. Research on LHX3 recombinant protein focuses on understanding its structural and functional properties, which can reveal insights into its regulatory mechanisms during development. The production and study of LHX3 recombinant protein enable researchers to investigate its interactions with other molecular partners and elucidate its role in gene regulation. Furthermore, these studies have potential therapeutic implications, as understanding the molecular pathways involving LHX3 could contribute to the development of strategies for addressing related endocrine disorders. The recombinant protein can serve as a valuable tool for in vitro assays, aiding in drug discovery and the development of gene therapies targeting diseases linked to LHX3 dysregulation. Overall, the exploration of LHX3 recombinant protein stands at the intersection of developmental biology and clinical research, making it a significant focus in both basic and applied science.











