Analytical Data
-
Gene name
Cyp3a11
- Application
-
Alternative Names
Cyp3a11；BHLHB3；DEC2；SHARP1；Class E basic helix-loop-helix Protein 41
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q64459
-
Expression Region
1-504aa
-
AA Sequence
MDLVSALSLETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPRDAVITGA
-
Molecular Weight
65.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP3A11 is a member of the cytochrome P450 superfamily, which plays a crucial role in the metabolism of various endogenous compounds and xenobiotics, including drugs. It is primarily expressed in the liver and is involved in the biotransformation of steroids, fatty acids, and numerous pharmaceuticals. Research on CYP3A11 is significant due to its implications in pharmacogenomics, where genetic variability can influence drug metabolism and response in individuals. Given the interindividual differences in CYP3A11 expression and activity, studying its recombinant form enables researchers to better understand its enzymatic mechanisms and interactions with various substrates. The production of recombinant CYP3A11 in suitable expression systems, such as yeast or mammalian cells, allows for detailed kinetic studies and structure-function analyses. These investigations are essential for predicting drug-drug interactions, optimizing therapeutic regimens, and developing strategies to mitigate adverse drug reactions, thereby enhancing personalized medicine approaches. Additionally, the understanding of CYP3A11's role in steroid metabolism may provide insights into conditions related to hormonal dysregulation. Overall, the research into CYP3A11 and its recombinant protein can aid in the advancement of pharmacological sciences and improve patient outcomes in drug therapy.
