Analytical Data
-
Gene name
LARP2
- Application
-
Alternative Names
LARP1B; LARP2; La-related protein 1B; La ribonucleoprotein domain family member 1B; La ribonucleoprotein domain family member 2; La-related protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q659C4
-
Expression Region
1-201aa
-
AA Sequence
MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LARP2, or La-related protein 2, is a highly conserved RNA-binding protein that plays a critical role in the regulation of gene expression at the post-transcriptional level. This protein is involved in several cellular processes, including mRNA stability, translation initiation, and ribosome assembly. The study of LARP2 has gained prominence due to its implications in various biological functions and disease mechanisms, particularly in cancer and neurological disorders. Research has shown that LARP2 is integral to the regulation of specific mRNAs involved in cell proliferation and stress response, highlighting its potential as a therapeutic target. Moreover, understanding the structure and function of LARP2 at the molecular level can provide insights into its interactions with RNA and other protein partners. The recombinant expression and purification of LARP2 allow for detailed biochemical and biophysical studies, enabling researchers to explore its role in mRNA metabolism and translational control. Consequently, investigating LARP2 not only enhances our comprehension of fundamental cellular processes but also opens avenues for developing novel strategies in disease treatment and management. As a result, LARP2 research is positioned at the intersection of molecular biology and therapeutic innovation, making it a focal point of current biomedical investigations.
