Analytical Data
-
Gene name
CYBb
- Application
-
Alternative Names
CYBb；P51NOX；NADPH oxidase activator 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P04839
-
Expression Region
283-570aa
-
AA Sequence
ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF
-
Molecular Weight
37.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYBb, also known as cytochrome b-245 beta chain, is a crucial component of the NADPH oxidase complex, which plays a pivotal role in the immune system by generating reactive oxygen species (ROS) to combat pathogens. Research on CYBb, particularly through recombinant protein technology, has gained significant attention due to its implications in various diseases, including chronic granulomatous disease (CGD), an inherited immunodeficiency disorder caused by defects in the NADPH oxidase complex. Understanding the structure, function, and regulation of CYBb can provide insights into the mechanisms underlying immune responses and oxidative stress. Furthermore, recombinant CYBb can be utilized in diagnostic assays and therapeutic interventions, helping to elucidate its role in cellular signaling and disease pathology. Studies aim to characterize the protein's interactions and stability, assess its enzymatic functions, and explore its potential as a target for drug development. By harnessing the advances in protein engineering and purification techniques, researchers are paving the way for innovative applications of CYBb in both basic and translational research, potentially leading to improved treatments for immune-related disorders and enhancing our understanding of oxidative stress and inflammation in various diseases.
