Cat: PA1000-1992

Recombinant Human MMP8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP8;CLG1;Neutrophil collagenase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22894

  • Expression Region

    101-467aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSLTPGNPKWERTNLTYRIRNYTPQLSEA EVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPN GILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAH SSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPK PCDPSLTFDAITTLRGEILFFKDRYFWRRHPQLQRVEMNFISLFWPSLPT GIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDISNYGFPSSVQAI DAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGIESKVDAV FQQEHFFHVFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Matrix metalloproteinase 8 (MMP-8), also known as collagenase-2, is a crucial enzyme in the matrix metalloproteinase family, primarily involved in the degradation of collagen and other extracellular matrix components. This enzyme plays a significant role in various physiological processes, including tissue remodeling, wound healing, and inflammation. Its dysregulation is associated with a range of pathological conditions, including arthritis, cancer metastasis, and cardiovascular diseases. Research on MMP-8 has gained momentum due to its potential as a therapeutic target and biomarker for disease progression. The recombinant expression of MMP-8 allows for the production of this protein in a purified form, facilitating studies on its structure-function relationships, regulatory mechanisms, and inhibitors. Such studies are essential for understanding the detailed role of MMP-8 in health and disease and for developing novel therapeutic strategies that may involve MMP-8 modulation. Advances in recombinant DNA technology have enabled researchers to produce active MMP-8 with significant yields, further encouraging investigations into its biochemical properties and potential applications in clinical settings. As a result, MMP-8 continues to be a focus of research aimed at unraveling the complexities of extracellular matrix dynamics and developing targeted interventions for related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US