Cat: PA1000-1989

Recombinant Human MMP28 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP28

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP28;MMP25;Matrix metalloProteinase-28

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H239

  • Expression Region

    123-520aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSFAKQGNKWYKQHLSYRLVNWPEHLPEP AVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGDHNDGLGNAFD GPGGALAHAFLPRRGEAHFDQDERWSLSRRRGRNLFVVLAHEIGHTLGLT HSPAPRALMAPYYKRLGRDALLSWDDVLAVQSLYGKPLGGSVAVQLPGKL FTDFETWDSYSPQGRRPETQGPKYCHSSFDAITVDRQQQLYIFKGSHFWE VAADGNVSEPRPLQERWVGLPPNIEAAAVSLNDGDFYFFKGGRCWRFRGP KPVWGLPQLCRAGGLPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVE PYYPRSLQDWGGIPEEVSGALPRPDGSIIFFRDDRYWRLDQAKLQATTSG RWATELPWMG CWHANSGSALF

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MMP28, also known as membrane-type matrix metalloproteinase (MT-MMP), is a member of the matrix metalloproteinase (MMP) family, known for its involvement in the degradation of extracellular matrix components. Unlike other MMPs, MMP28 is uniquely localized to the cell membrane, which facilitates its role in various biological processes, including tissue remodeling, cell migration, and apoptosis. Research has shown that MMP28 is particularly significant in cancer progression, wound healing, and inflammation. Its expression is often correlated with aggressive tumor behavior and poor prognosis in various cancers, suggesting that it may serve as a potential biomarker for malignancy. The recombinant protein of MMP28 has become a focus of study due to its potential therapeutic applications and ability to provide insight into the mechanisms of tumor invasion and metastasis. By utilizing recombinant technology, researchers can generate active MMP28 for in vitro studies, enabling a deeper understanding of its substrate specificity and regulatory mechanisms. This research contributes not only to the basic understanding of MMP biology but also to the development of novel therapeutic strategies targeting MMP28 in cancer and other diseases involving extracellular matrix remodeling. Overall, the investigation of MMP28 as a recombinant protein holds promise for both basic and applied biomedical research, paving the way for innovative approaches in cancer treatment and tissue engineering.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US