Cat: PA1000-1988

Recombinant Human MMP23B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP23B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP23B;MMP21;MMP22;Matrix metalloProteinase-23

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75900

  • Expression Region

    79-254aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSYTLTPARLRWDHFNLTYRILSFPRNLL SPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYPINHTDCLVS ALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDL VHVAAHEIGHALGLMHSQHGRALMHLNATLRGWKALSQDELWGLHRLYG

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MMP23B, or Matrix Metalloproteinase 23B, is a member of the matrix metalloproteinase (MMP) family, which plays a crucial role in the degradation of extracellular matrix components. This protein is primarily implicated in various physiological and pathological processes, including tissue remodeling, wound healing, and inflammation. Recent studies have highlighted the potential involvement of MMP23B in several diseases, such as cancer, arthritis, and cardiovascular disorders, due to its ability to regulate cellular environments and promote tumor invasion and metastasis. The understanding of MMP23B's function and mechanism of action has garnered interest in the scientific community, as it may serve as a biomarker for disease progression and a target for therapeutic interventions. Recombinant MMP23B protein is being produced for experimental studies aimed at elucidating its role in cellular dynamics and to explore its interactions with other extracellular matrix components and signaling pathways. Such research endeavors could pave the way for novel treatment strategies and enhance our knowledge of matrix biology in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US