Cat: PA1000-1984

Recombinant Human MMP10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MMP10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MMP10;STMY2;Stromelysin-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09238

  • Expression Region

    99-476aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSFSSFPGMPKWRKTHLTYRIVNYTPDLP RDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDG PGHSLAHAYPPGPGLYGDIHFDDDEKWTEDASGTNLFLVAAHELGHSLGL FHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVP TKSVPSGSEMPAKCDPALSFDAISTLRGEYLFFKDRYFWRRSHWNPEPEF HLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGI HTLGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLI ADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLH C

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Matrix metalloproteinase 10 (MMP10), also known as stromelysin-2, is a member of the matrix metalloproteinase family, which plays a crucial role in extracellular matrix remodeling. This enzyme is involved in various physiological processes, including tissue repair, cell migration, and apoptosis, as well as pathological conditions such as cancer metastasis, cardiovascular diseases, and inflammatory disorders. Research on MMP10 has intensified due to its significant implications in disease mechanisms and potential therapeutic targets. Understanding the structure-function relationship of MMP10 and its regulatory mechanisms can provide insights into its role in disease progression. Additionally, its expression is modulated by various cytokines and growth factors, which underscores its complexity in biological processes. The study of recombinant MMP10 proteins has facilitated the investigation of its enzymatic activity, substrate specificity, and interaction with inhibitors. This research is essential for developing novel therapeutic strategies, leveraging MMP10 as a biomarker for disease states, and designing specific inhibitors that could potentially mitigate the adverse effects associated with its overexpression. Furthermore, MMP10's role in the tumor microenvironment emphasizes the need for thorough exploration of its functions in cancer biology. Overall, ongoing studies of recombinant MMP10 proteins not only enhance the understanding of its biological significance but also pave the way for innovative approaches in treating diseases linked to abnormal MMP activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US