Analytical Data
-
Gene name
MFAP4
- Application
-
Alternative Names
MFAP4;Microfibril-associated glycoProtein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55083
-
Expression Region
22-255aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSHMVSGIRGDALERFCLQQPLDCDDIYA QGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGW NDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYAD FSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFV QNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLK RTEMKIRRA
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MFAP4 (Microfibril-Associated Protein 4) is a secreted extracellular matrix protein primarily associated with the microfibrils of connective tissues, playing pivotal roles in tissue integrity, elasticity, and cellular signaling. Recent research highlights MFAP4's involvement in various physiological and pathological processes, including tissue repair, fibrosis, and vascular remodeling. Elevated levels of MFAP4 have been linked to several disease states, such as cardiovascular disorders and certain cancers, revealing its potential as a biomarker for disease progression and a therapeutic target. The recombinant expression of MFAP4 provides a valuable tool for studying its functional properties and interactions within the extracellular matrix. By producing recombinant MFAP4, researchers aim to elucidate its role in microfibril assembly, cellular adhesion, and migration, which are crucial for understanding its contributions to tissue homeostasis and disease. Moreover, recombinant MFAP4 can be used in in vitro experiments to mimic its physiological conditions, offering insights into the molecular mechanisms underlying its actions. Understanding MFAP4's structure and function could pave the way for novel therapeutic strategies targeting connective tissue disorders and associated diseases. This research not only enhances our comprehension of extracellular matrix components but also opens doors for innovative biomedical applications utilizing MFAP4 in regenerative medicine and tissue engineering.
