Analytical Data
-
Gene name
KRTAP19-4
- Application
-
Alternative Names
KRTAP19-4; KAP19.4Keratin-associated protein 19-4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3LI73
-
Expression Region
1-84aa
-
AA Sequence
MSYYGSYYRGLGYGCGGFGGLGYGYGCGCGSFRRLGYGCGFGGNGYGYCRPSCYGGYGFSILLKSYPEDTISEVIRRSFNLTKY
-
Molecular Weight
9.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP19-4, a member of the keratin-associated protein (KRTAP) family, plays a vital role in the composition and structure of hair and wool fibers. The KRTAP genes are known for their involvement in determining the elasticity, strength, and integrity of keratin fibers, which are essential for various biological functions and applications in the textile industry. Research into KRTAP19-4 has gained significance due to its potential impact on the quality of animal fibers, which are economically important for wool and textile production. Recent studies have focused on understanding the molecular mechanisms underlying its expression and functional roles in keratinocyte biology, as well as its contribution to phenotypic variations observed in different breeds. Moreover, the potential for KRTAP19-4 to serve as a genetic marker for selective breeding programs highlights its relevance in agricultural biotechnology. Investigations into the modulation of KRTAP19-4 expression through environmental factors, nutrition, and genetic engineering could provide insights into enhancing fiber quality and animal performance.Overall, the study of KRTAP19-4 is poised at the intersection of molecular biology, genetics, and agricultural science, with implications for improving both the economic viability of wool production and our understanding of keratin biology.
