Analytical Data
-
Gene name
DVL1
- Application
-
Alternative Names
DVL1;Segment polarity Protein dishevelled homolog DVL-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14640
-
Expression Region
1-110aa
-
AA Sequence
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFK SMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHT DLPPPLERTG
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DVL1, or Dishevelled Segment Polarity Protein 1, is a crucial component of the Wnt signaling pathway, which plays a significant role in various biological processes, including cell proliferation, differentiation, and tissue homeostasis. Research into DVL1 has gained momentum due to its involvement in developmental processes and its implications in various diseases, particularly cancers. Abnormalities in Wnt signaling, mediated by DVL1, can lead to oncogenesis, making it a potential target for therapeutic intervention. The study of recombinant DVL1 proteins allows for a deeper understanding of its molecular mechanisms and interactions, providing insights into how perturbations in its function contribute to disease states. Moreover, examining DVL1's structure and function can reveal potential binding sites for small molecules, presenting opportunities for drug development. As researchers develop various methods to produce and purify recombinant DVL1, such studies can also facilitate the design of specific inhibitors or activators that modulate the Wnt pathway, which could ultimately pave the way for innovative treatments for cancer and other disorders associated with dysregulated Wnt signaling.











