Analytical Data
-
Gene name
KRR1
- Application
-
Alternative Names
HIV 1 Rev binding protein 2; HIV-1 Rev-binding protein 2; HRB2; KRR1; KRR1 small subunit processome component homolog; KRR1; small subunit (SSU) processome component; homolog (yeast); KRR1_HUMAN; Rev interacting protein 1; Rev-interacting protein 1; RIP 1 ; Rip-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13601
-
Expression Region
1-381aa
-
AA Sequence
MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK
-
Molecular Weight
70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRR1 (K-repressor of RNA polymerase I) is a key regulator implicated in the transcription of ribosomal RNA (rRNA) and is crucial for ribosome biogenesis. Understanding KRR1's role has garnered interest due to its potential impact on cellular growth and proliferation, which are often altered in various diseases, including cancer. Research has indicated that KRR1 interacts with other essential proteins involved in the rRNA transcription process, thereby influencing the ribosomal assembly and function. The study of KRR1, particularly through the development of recombinant protein technologies, allows for the detailed examination of its structural and functional properties. Developing KRR1 as a recombinant protein presents opportunities to investigate its interactions and mechanisms of action in controlled experimental settings. Additionally, elucidating the pathways involving KRR1 could provide insights into its function in cellular stress responses and oncogenesis. As researchers explore the therapeutic potentials of targeting the pathways related to KRR1, understanding its biochemical properties and physiological roles becomes imperative for leveraging this knowledge in biomedical applications, potentially leading to novel strategies in cancer treatment and other diseases linked to ribosomal dysfunction. Therefore, the investigation of KRR1 as a recombinant protein not only advances basic scientific knowledge but also holds promise for translational research that could improve therapeutic outcomes.
