Analytical Data
-
Gene name
KPRP
- Application
-
Alternative Names
C1orf45; hKPRP; Keratinocyte expressed; proline-rich protein; Keratinocyte proline-rich protein; Kprp; KPRP_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5T749
-
Expression Region
1-579aa
-
AA Sequence
MCDQQQIQCRLPLQQCCVKGPSFCSSQSPFAQSQVVVQAPCEMQIVDCPASCPVQVCQVSDQAPCQSQTTQVKCQSKTKQVKGQAQCQSKTTQVKGQAASQSQTSSVQSQAPCQSEVSYVQCEASQPVQTCFVECAPVCYTETCYVECPVQNYVPCPAPQPVQMYRGRPAVCQPQGRFSTQCQYQGSYSSCGPQFQSRATCNNYTPQFQLRPSYSSCFPQYRSRTSFSPCVPQCQTQGSYGSFTEQHRSRSTSRCLPPPRRLQLFPRSCSPPRRFEPCSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPRQVPPQRCPVEIPPIRRRSQSCGPQPSWGASCPELRPHVEPRPLPSFCPPRRLDQCPESPLQRCPPPAPRPRLRPEPCISLEPRPRPLPRQLSEPCLYPEPLPALRPTPRPVPLPRPGQCEIPEPRPCLQPCEHPEPCPRPEPIPLPAPCPSPEPCRETWRSPSPCWGPNPVPYPGDLGCHESSPHRLDTEAPYCGPSSYNQGQESGAGCGPGDVFPERRGQDGHGDQGNAFAGVKGEAKSAYF
-
Molecular Weight
90.09 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KPRP (Keratinocyte Proliferating Peptide) is a recently identified recombinant protein that plays a crucial role in skin biology and wound healing. Research into KPRP has gained momentum due to its potential applications in regenerative medicine, particularly in the treatment of skin injuries and diseases. The protein is derived from keratinocytes, the predominant cell type in the epidermis, and has been shown to stimulate cell proliferation and migration, critical processes in the skin repair mechanism. Previous studies suggest that KPRP interacts with various cellular signaling pathways, enhancing keratinocyte activity and supporting tissue regeneration. The increasing prevalence of chronic wounds and skin-related disorders underscores the need for effective therapeutic strategies, positioning KPRP as a promising candidate for clinical applications. Additionally, understanding the molecular mechanisms by which KPRP operates could lead to the development of novel treatments that leverage its regenerative properties, making it an important focus of contemporary dermatological research. With the push towards biotechnological advancements, KPRP could pave the way for innovative approaches in managing skin health and improving patient outcomes.
