Analytical Data
-
Gene name
CD163L1
- Application
-
Alternative Names
CD163L1；CD163B；M160；Scavenger receptor cysteine-rich type 1 Protein M160
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR16
-
Expression Region
48-469aa
-
AA Sequence
LRLVNGDGPCSGTVEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGNESALWECQHREWGSHNCYHGEDVGVNCYGEANLGLRLVDGNNSCSGRVEVKFQERWGTICDDGWNLNTAAVVCRQLGCPSSFISSGVVNSPAVLRPIWLDDILCQGNELALWNCRHRGWGNHDCSHNEDVTLTCYDSSDLELRLVGGTNRCMGRVELKIQGRWGTVCHHKWNNAAADVVCKQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSGTVNFDCLHQNDVSVICSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSRRAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICS
-
Molecular Weight
54.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD163L1, a member of the scavenger receptor cysteine-rich (SRCR) family, has garnered significant attention in recent years due to its potential role in immune regulation and tissue homeostasis. It is primarily expressed in macrophages and dendritic cells, where it functions as an important receptor involved in the recognition and clearance of modified lipoproteins and other ligands, contributing to anti-inflammatory responses and tissue repair processes. Research has suggested that CD163L1 may influence various pathological conditions, including autoimmune diseases, infections, and cancer, by modulating macrophage polarization and promoting tissue regeneration. The recombinant protein of CD163L1 has been engineered to facilitate in-depth studies of its biological functions, interactions with ligands, and potential therapeutic applications. This includes exploring its role as a biomarker for disease progression or response to therapy, and as a target for novel treatment strategies aimed at enhancing immune responses or mitigating inflammation. As the understanding of CD163L1 expands, its relevance in both normal physiology and disease states continues to emerge, underscoring the importance of recombinant protein studies in elucidating its mechanisms of action and therapeutic potentials.
