Analytical Data
-
Gene name
AMELY
- Application
-
Alternative Names
AMELY；AMGL；AMGY；Amelogenin. Y isoform
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99218
-
Expression Region
17-102aa
-
AA Sequence
MPLPPHPGHPGYINFSYENSHSQAINVDRIALVLTPLKWYQSMIRPPYSSYGYEPMGGWLHHQIIPVVSQQHPLTHTLQSHHHIPV
-
Molecular Weight
17.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AMELY, or Amelogenin Y, is a protein predominantly expressed in male mammals, playing a crucial role in the development of teeth and enamel formation. The study of AMELY is essential for understanding the molecular mechanisms behind tooth biomineralization and the genetic regulation of dental structures. Unlike its counterpart AMELX, which is found on the X chromosome, AMELY is located on the Y chromosome, making it a valuable marker for sex determination in forensic science and evolutionary studies. Recent advancements in recombinant protein technology have enabled researchers to produce and analyze AMELY in laboratory settings, facilitating the exploration of its functional properties and interactions with other proteins involved in enamel formation. Investigations into the recombinant forms of AMELY can lead to insights into its role in dental abnormalities and enamel dysplasia, which are often correlated with genetic variations. Moreover, understanding AMELY’s structure-function relationships holds promise for applications in regenerative dentistry and biomaterials development. As the genetic understanding of dental development continues to evolve, AMELY's study contributes to broader implications in evolutionary biology, genetics, and clinical dentistry, reinforcing its significance in both basic research and applied sciences.
