Analytical Data
-
Gene name
MAGEA3
- Application
-
Alternative Names
MAGEA3;MAGE3;Melanoma-associated antigen 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43357
-
Expression Region
1-314aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMPLEQRSQHCKPEEGLEARGEALGLVG AQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNY PLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAR EPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYI FATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSV LEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRA LVETSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAGEA3 is a member of the MAGE (melanoma antigen gene) family, which encodes tumor-associated antigens that are predominantly expressed in various cancers, but not in normal tissues, making them attractive targets for immunotherapy. Research has highlighted MAGEA3’s potential role in enhancing tumor immune responses, particularly in malignancies such as melanoma, lung cancer, and bladder cancer. Its expression is often correlated with poor prognosis, and its unique antigenic properties have led to exploration in vaccine development and adoptive cell therapies. The recombinant MAGEA3 protein offers valuable insights into its immunogenicity and interaction with the immune system, paving the way for innovative therapeutic strategies. Studies utilizing MAGEA3 recombinant proteins have aimed to elucidate mechanisms of immune recognition and response, evaluate the efficacy of MAGEA3-based vaccines, and optimize T-cell receptor (TCR) engineering in adoptive cellular treatments. Furthermore, as a biomarker, MAGEA3 helps in the identification of patients who might benefit from immune checkpoint inhibitors or personalized cancer vaccines. Collectively, research on MAGEA3 recombinant protein underscores its significance in the realm of cancer immunotherapy, aiming to improve patient outcomes through targeted immune modulation strategies. Additionally, understanding the biology of MAGEA3 may reveal insights into tumor evolution and antigen escape mechanisms, contributing to the development of more effective cancer management approaches.
