Analytical Data
-
Gene name
CNCbl
- Application
-
Alternative Names
CNCbl；Cyanocobalamin reductase / alkylcobalamin dealkylase
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
C1E237
-
Expression Region
1-300aa
-
AA Sequence
MKKPEPVVKVDETGPPKAAVAGAVGVAVAVAWRLFISRMRNAGGAGRNNAWKTVTADAKEKLAAAGFDIVAPLKLRWYNEIAPDSAKIAPGGAMGEDALVILVGNSAALWPVFCDAHNARPEIGDAENPVDTYVDIEVNRVFRGKIRRVFYAHETKPGRLVAVQRMAHVAGVAHLDERSHLSIHPTLGPWLAFRAVVVLDDARGPGDGQKPRPPPNPLAFDPSARARVDEAFDDALDGYEAPGGPSEGQWRLWVAVRDAVEPGHPARYPEDQVAYHYNCLDGRERARIRSRLRGGFEPSD
-
Molecular Weight
32.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNCbl, or Cobalt Nanocube-bound protein, represents a significant advancement in the field of protein engineering and biotechnology. This area of research emerged from the need to explore innovative methods for protein purification, stabilization, and targeted delivery. Traditional protein expression systems often encounter challenges such as low yields, denaturation, and difficulties in handling complex proteins. CNCbl addresses these issues through its unique cobalt nanocube technology, which acts as a scaffolding platform for recombinant proteins. This technology leverages the high surface-to-volume ratio and biocompatibility of nanocubes, enhancing the stability and functionality of the proteins. Additionally, CNCbl has potential applications in biocatalysis, drug delivery, and biomedical imaging, making it a valuable tool in both industrial and clinical settings. The study of CNCbl not only expands our understanding of protein interactions and functionalities but also presents opportunities for novel therapeutic strategies. As research progresses, further insights into the mechanisms of CNCbl binding and the manipulation of its properties could lead to the development of more efficient and effective biotechnological applications.
