Analytical Data
-
Gene name
VB1
- Application
-
Alternative Names
VB1;Leydig cell tumor 10 kDa Protein homolog
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNZ5
-
Expression Region
1-99aa
-
AA Sequence
MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASSSLPKKLALLKAPAKKKGAAAATSSKTPS
-
Molecular Weight
10.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VB1 recombinant protein is derived from the viral protein found in the coxsackievirus, which is known for its role in various human diseases, including myocarditis and other inflammatory conditions. With the growing interest in viral pathogenesis and the immune responses they elicit, research on VB1 has gained momentum as scientists seek to understand its structure-function relationship and potential therapeutic applications. The protein has shown promise in studies related to vaccine development and antibody responses, highlighting its potential as a target for immunotherapy. Furthermore, by characterizing the VB1 recombinant protein, researchers aim to unveil the mechanisms of viral entry and replication, as well as the host immune evasion strategies employed by the virus. This knowledge is crucial for developing effective diagnostic tools and treatments for diseases associated with coxsackievirus infection. The production of VB1 as a recombinant protein also facilitates the exploration of its immunogenic properties, paving the way for future studies on vaccine candidates that could elicit a robust immune response. As such, the ongoing research on VB1 recombinant protein not only contributes to our understanding of viral infections but also holds the potential to impact public health positively through novel therapeutic interventions.











