Cat: PA2000-411DB

Recombinant Human VB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VB1;Leydig cell tumor 10 kDa Protein homolog

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UNZ5

  • Expression Region

    1-99aa

  • AA Sequence

    MAQGQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPKKARVVQQQKLKKNLEVGIRKKIEHDVVMKASSSLPKKLALLKAPAKKKGAAAATSSKTPS

  • Molecular Weight

    10.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VB1 recombinant protein is derived from the viral protein found in the coxsackievirus, which is known for its role in various human diseases, including myocarditis and other inflammatory conditions. With the growing interest in viral pathogenesis and the immune responses they elicit, research on VB1 has gained momentum as scientists seek to understand its structure-function relationship and potential therapeutic applications. The protein has shown promise in studies related to vaccine development and antibody responses, highlighting its potential as a target for immunotherapy. Furthermore, by characterizing the VB1 recombinant protein, researchers aim to unveil the mechanisms of viral entry and replication, as well as the host immune evasion strategies employed by the virus. This knowledge is crucial for developing effective diagnostic tools and treatments for diseases associated with coxsackievirus infection. The production of VB1 as a recombinant protein also facilitates the exploration of its immunogenic properties, paving the way for future studies on vaccine candidates that could elicit a robust immune response. As such, the ongoing research on VB1 recombinant protein not only contributes to our understanding of viral infections but also holds the potential to impact public health positively through novel therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US