Analytical Data
-
Gene name
SY
- Application
-
Alternative Names
SY；SVP65；SYT；Synaptotagmin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P21579
-
Expression Region
99-416aa
-
AA Sequence
KNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDA
-
Molecular Weight
40.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SY recombinant protein studies have garnered significant attention due to their potential applications in various fields, including medicine, biotechnology, and molecular biology. Recombinant proteins are produced by inserting the gene encoding a specific protein into host organisms, enabling large-scale production for research and therapeutic purposes. The SY protein, derived from a specific source, exhibits unique properties that make it a candidate for applications in drug development, vaccine production, and enzyme engineering. Research into SY recombinant proteins focuses on optimizing expression and purification processes to enhance yield and functionality. Furthermore, understanding the structural and functional characteristics of SY protein can aid in elucidating its role in biological systems and its interactions with other molecules. This knowledge is crucial for developing innovative solutions to pressing health challenges, such as infectious diseases and genetic disorders. The continuous exploration of SY recombinant proteins not only advances scientific knowledge but also potentially leads to breakthroughs in targeted therapies and diagnostic tools. Thus, the study of SY recombinant proteins represents a vital intersection of research, innovation, and practical application, contributing to the advancement of life sciences and improving human health outcomes.
