Analytical Data
-
Gene name
ccdA
- Application
-
Alternative Names
ccdA；CCDC10；CSDUFD1；FSD1CL；FSD1-like Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q46995
-
Expression Region
1-72aa
-
AA Sequence
MKQRITVAGDSDNYQLLKAYDVNISGLVSTPMQNEARRLRPERWKVANQEGMAEVARFIEMNGSFADENRDW
-
Molecular Weight
15.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on the recombinant protein CCDAs (cystathionine gamma-lyase-derived antibiotic) has gained considerable attention in the field of microbiology and pharmacology due to its potential therapeutic applications. CCDAs are derived from the cystathionine gamma-lyase enzyme, which plays a critical role in the transsulfuration pathway, crucial for amino acid metabolism and the synthesis of bioactive compounds. The recombinant production of CCDAs allows for high-throughput generation and purification, facilitating the study of their structure-function relationships. These proteins have shown promise in eliciting antimicrobial and antifungal activities, making them candidates for the development of novel antibiotics in response to rising antibiotic resistance. Moreover, understanding the mechanism of action of CCDAs can lead to the identification of new drug targets and the design of more effective therapeutic agents. Researchers are also exploring their synergistic effects with existing antibiotics, which could enhance the efficacy of treatment regimens. Overall, the investigation of recombinant CCDAs not only contributes to our understanding of microbial metabolism but also represents a significant stride towards innovative approaches in combating infectious diseases.
