Cat: PA2000-4608

Recombinant Human EPS15 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EPS15

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EPS15;AF1P;Epidermal growth factor receptor substrate 15

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42566

  • Expression Region

    657-798aa

  • AA Sequence

    CFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPD

  • Molecular Weight

    20.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EPS15, or Epithelial Protein Lost in Neoplasm 15, is a vital protein involved in the regulation of cellular processes such as endocytosis and cellular signaling. Its role as an adaptor protein makes it critical in the formation of clathrin-coated pits, thus influencing the internalization of various membrane receptors, including growth factor receptors. The research surrounding EPS15 gained momentum due to its association with cancer; altered expression levels of this protein have been observed in various neoplastic conditions, suggesting that it may function as a tumor suppressor. The reconstitution of EPS15, particularly in the context of cell signaling and endocytosis, has become a focal point for scientists aiming to decipher the molecular underpinnings of tumorigenesis. Furthermore, understanding the structure-function relationship of EPS15 can help in developing therapeutic strategies targeting cancer by restoring or mimicking its normal function. Recent advancements in biophysical techniques, including crystallography and cryo-electron microscopy, have provided insights into its structure, which in turn can aid in the design of small molecules to modulate its activity. Ultimately, studying EPS15 through recombinant techniques not only enhances our comprehension of its biological roles but also holds promise for novel cancer treatment methodologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US