Analytical Data
-
Gene name
BRD4
- Application
-
Alternative Names
BRD4；HUNK1；Bromodomain-containing Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60885
-
Expression Region
49-170aa
-
AA Sequence
ETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYY KIIKTPMDMGTIKKRLENNYYWNAQECIQDFN TMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETE
-
Molecular Weight
15 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BRD4 (Bromodomain-containing protein 4) is a crucial member of the BET (bromodomain and extraterminal domain) protein family, which plays a significant role in regulating gene expression by interacting with acetylated lysines on histones. Initially identified for its role in transcriptional activation and involvement in cell cycle regulation, BRD4 has garnered attention due to its implications in various cancers and other diseases, notably through its association with the expression of proto-oncogenes. The study of recombinant BRD4 proteins allows researchers to investigate the specific mechanisms of BRD4 function, its interactions with chromatin, and its potential as a therapeutic target. By producing BRD4 in a controlled laboratory setting, scientists can elucidate its structural and functional properties, screen for small molecule inhibitors, and explore its role as a co-activator in oncogenic pathways. Additionally, understanding BRD4's dynamic roles in cellular processes such as differentiation, inflammation, and viral replication is essential for developing targeted therapies. Given the promising results from preclinical studies with BET inhibitors in various cancer models, the research on BRD4-derived recombinant proteins is pivotal for advancing our understanding of its biology and enhancing drug discovery efforts tailored to combat diseases linked to aberrant BRD4 activity.
