Analytical Data
-
Gene name
nuc1
- Application
-
Alternative Names
nuc1；NR1C2；PPARB；Peroxisome proliferator-activated receptor delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q03181
-
Expression Region
165-441aa
-
AA Sequence
GSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
-
Molecular Weight
49.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nuc1, a recombinant protein derived from the nuclease enzyme family, plays a crucial role in various biological processes, particularly in DNA metabolism and cellular responses to stress. Its study has gained significant attention due to its potential applications in molecular biology and biotechnology. Understanding the structure and functional mechanisms of Nuc1 is essential for its utilization in gene editing, recombinant DNA technology, and therapeutic interventions. Recent advances in protein engineering and expression systems have facilitated the production of Nuc1 in various host organisms, enabling researchers to explore its enzymatic activity and interaction with nucleic acids. Furthermore, Nuc1 has been implicated in studies of apoptosis and cellular signaling, making it a valuable target for therapeutic strategies in diseases characterized by dysregulated cell death. Ongoing research aims to elucidate the biochemical pathways involving Nuc1, which may lead to novel insights in both basic and applied sciences, including cancer research and the development of innovative biopharmaceuticals. The ongoing exploration of Nuc1 underscores its relevance in advancing our understanding of molecular mechanisms and enhancing biotechnological applications.
