Analytical Data
-
Gene name
LAMa2
- Application
-
Alternative Names
LAMa2；LAMM；Laminin subunit alpha-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24043
-
Expression Region
3013-3122aa
-
AA Sequence
DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTND PVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELR GVQPVSCPAN
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on LAMa2 recombinant proteins focuses on understanding the functional roles and therapeutic potential of the LAMa2 protein, a crucial component of the extracellular matrix in various tissues, particularly in muscle development and repair. LAMa2, a laminin isoform, is essential for cellular adhesion, migration, and differentiation, playing a pivotal role in the formation of the neuromuscular junction and maintaining muscle integrity. Mutations in the LAMa2 gene have been linked to severe muscular dystrophies, such as merosin-deficient congenital muscular dystrophy (MDC1A), highlighting the need for targeted therapies. By producing recombinant LAMa2, researchers aim to investigate its structural properties, biological activity, and interactions with other cellular components, which could lead to innovative treatment strategies. This protein's application in regenerative medicine could provide insights into muscle repair mechanisms and the development of therapies for debilitating muscle disorders. Overall, LAMa2 recombinant protein studies are crucial for unraveling the complexities of muscle biology and developing effective interventions for related diseases.
