Cat: PA2000-375DB

Recombinant Human LAMa2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LAMa2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LAMa2;LAMM;Laminin subunit alpha-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P24043

  • Expression Region

    3013-3122aa

  • AA Sequence

    DAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTND PVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELR GVQPVSCPAN

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on LAMa2 recombinant proteins focuses on understanding the functional roles and therapeutic potential of the LAMa2 protein, a crucial component of the extracellular matrix in various tissues, particularly in muscle development and repair. LAMa2, a laminin isoform, is essential for cellular adhesion, migration, and differentiation, playing a pivotal role in the formation of the neuromuscular junction and maintaining muscle integrity. Mutations in the LAMa2 gene have been linked to severe muscular dystrophies, such as merosin-deficient congenital muscular dystrophy (MDC1A), highlighting the need for targeted therapies. By producing recombinant LAMa2, researchers aim to investigate its structural properties, biological activity, and interactions with other cellular components, which could lead to innovative treatment strategies. This protein's application in regenerative medicine could provide insights into muscle repair mechanisms and the development of therapies for debilitating muscle disorders. Overall, LAMa2 recombinant protein studies are crucial for unraveling the complexities of muscle biology and developing effective interventions for related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US