Analytical Data
-
Gene name
Nus1
- Application
-
Alternative Names
Nus1；C6orf68；NGBR；Dehydrodolichyl diphosphate synthase complex subunit NUS1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99LJ8
-
Expression Region
140-297aa
-
AA Sequence
DHQGIFKRNNSRLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDGKADIVRAAQDFCQLVAQQQRKPTDLDVDLLGSLLSSHGFPDPDLVLKFGPVDSTLGFLPWQIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
-
Molecular Weight
19.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nus1 is a significant protein known for its role in the regulation of gene expression in various organisms, including yeast, plants, and mammals. It belongs to the Nus family of proteins, which are involved in transcription processes and RNA processing. The understanding of Nus1's function has garnered attention in the field of molecular biology due to its potential implications in developmental biology and disease. Research on Nus1 has revealed its involvement in the modulation of transcription elongation and termination, crucial for ensuring proper mRNA synthesis and stability. Furthermore, studies have indicated that Nus1 may interact with other transcription factors and RNA-binding proteins, highlighting its role within complex regulatory networks. Given its functional diversity, there is growing interest in characterizing Nus1 through recombinant protein techniques, which provide insights into its structure and mechanisms of action. By producing Nus1 as a recombinant protein, researchers can conduct detailed biochemical assays and structural analyses, paving the way for the development of targeted therapies that could address diseases linked to transcriptional dysregulation. Thus, the exploration of Nus1 through recombinant protein research is pivotal for advancing our understanding of gene regulation and its broader implications in health and disease.
