Cat: PA1000-1809

Recombinant Human Lgals7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Lgals7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LGALS7;PIG1;LGALS7B;Galectin-7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P47929

  • Expression Region

    2-136aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHGNLYFQGGEFSNVPHKSSLPEGIRPGTVLRI RGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGR EERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLV EVGGDVQLDSVRIF

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Lgals7, also known as Galectin-7, is a member of the galectin family of proteins that bind β-galactosides and are involved in various biological processes, including cell adhesion, differentiation, and apoptosis. Research into Lgals7 has gained momentum due to its implications in multiple diseases, particularly in cancer, where it has been shown to play a role in tumor progression, metastasis, and immune response. Elevated levels of Lgals7 have been associated with poor prognosis in various cancer types, making it a potential biomarker and therapeutic target. Furthermore, its involvement in skin diseases and inflammatory disorders highlights the need for a deeper understanding of its molecular mechanisms. The recombinant expression and purification of Lgals7 enable researchers to investigate its structure-function relationship, assess its interactions with glycoproteins, and explore its potential as a therapeutic agent. By utilizing modern biotechnological techniques, studies of Lgals7 can provide critical insights into its roles in health and disease, paving the way for novel diagnostic and treatment strategies aimed at targeting this versatile protein. Overall, the characterization of Lgals7 and its recombinant forms represents a vital step toward elucidating its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US