Analytical Data
-
Gene name
Lgals7
- Application
-
Alternative Names
LGALS7;PIG1;LGALS7B;Galectin-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P47929
-
Expression Region
2-136aa
-
AA Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFSNVPHKSSLPEGIRPGTVLRI RGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGR EERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLV EVGGDVQLDSVRIF
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Lgals7, also known as Galectin-7, is a member of the galectin family of proteins that bind β-galactosides and are involved in various biological processes, including cell adhesion, differentiation, and apoptosis. Research into Lgals7 has gained momentum due to its implications in multiple diseases, particularly in cancer, where it has been shown to play a role in tumor progression, metastasis, and immune response. Elevated levels of Lgals7 have been associated with poor prognosis in various cancer types, making it a potential biomarker and therapeutic target. Furthermore, its involvement in skin diseases and inflammatory disorders highlights the need for a deeper understanding of its molecular mechanisms. The recombinant expression and purification of Lgals7 enable researchers to investigate its structure-function relationship, assess its interactions with glycoproteins, and explore its potential as a therapeutic agent. By utilizing modern biotechnological techniques, studies of Lgals7 can provide critical insights into its roles in health and disease, paving the way for novel diagnostic and treatment strategies aimed at targeting this versatile protein. Overall, the characterization of Lgals7 and its recombinant forms represents a vital step toward elucidating its biological significance and therapeutic potential.











