Cat: PA2000-372DB

Recombinant Human PDGF BB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PDGF BB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PDGF BB;PDGF2;SIS;Platelet-derived growth factor subunit B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P01127

  • Expression Region

    82-190aa

  • AA Sequence

    M+SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV

  • Molecular Weight

    12.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Platelet-Derived Growth Factor BB (PDGF-BB) is a crucial protein involved in regulating cellular processes such as proliferation, migration, and survival. It specifically binds to PDGF receptors on the surface of various cell types, playing a significant role in tissue repair, development, and angiogenesis. Research into PDGF-BB has gained traction due to its implications in various pathological conditions, including cancer, atherosclerosis, and fibrotic diseases. Overexpression or aberrant signaling of PDGF-BB can lead to uncontrolled cell growth and contribute to tumorigenesis. Therefore, scientists have focused on developing recombinant PDGF-BB proteins for therapeutic applications, particularly in wound healing and regenerative medicine. Recent studies have explored its efficacy in promoting the healing of chronic wounds and enhancing bone regeneration. By utilizing biotechnological methods to produce recombinant PDGF-BB, researchers aim to deliver this potent growth factor in a controlled manner, optimizing its biological activities while minimizing side effects. The ongoing investigation into PDGF-BB not only seeks to clarify its mechanistic role in various diseases but also to harness its therapeutic potential, making it a significant target for innovation in biomedical research and treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US