Analytical Data
-
Gene name
MP1
- Application
-
Alternative Names
MP1;5MP2;BZAP45;KIAA0005;eIF5-mimic Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHA4
-
Expression Region
1-124aa
-
AA Sequence
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
-
Molecular Weight
40.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of MP1 recombinant protein is rooted in the increasing interest in understanding protein interactions and their roles in cellular signaling pathways. MP1, known as "Monomeric Protein 1," is a key scaffold protein that interacts with various kinases, particularly in the MITogen-Activated Protein (MAP) kinase signaling cascade. This pathway is crucial for numerous cellular processes, including proliferation, differentiation, and response to stress. Dysregulation of MAP kinase signaling has been implicated in various diseases, including cancer, making it a significant target for therapeutic intervention. Researchers have turned to recombinant protein technologies to produce MP1 in a controlled environment, allowing for a detailed analysis of its structure, function, and interactions with other proteins. The recombinant production of MP1 provides a valuable tool for studying its role in cellular signaling and contributes to the broader understanding of complex protein networks. Insights gained from these studies may pave the way for novel therapeutic strategies, as they can elucidate the mechanisms by which MP1 and similar scaffold proteins influence cell behavior and disease progression. The ongoing research into MP1 recombinant protein represents a convergence of molecular biology, biochemistry, and therapeutic innovation, underscoring its significance in the field of biomedical research.











